US 8198242

I'll search for authoritative information on US 8198242 and any associated litigation.

Let me verify the granted claims of US 8,198,242 and look for any litigation involving this patent.

US Patent 8,198,242 — Analyst Summary

Caveat on scope: I searched the web (USPTO/Google Patents/Justia/CourtListener/PACER-derived dockets and PTAB filings). I found no CAFC docket, IPR, or PGR that names U.S. Patent No. 8,198,242 itself as the patent-in-suit. The 2026 CAFC activity I found involves related patents in the same BioMarin CNP family (details below). I did not have direct credentialed access to USPTO PatentCenter/PTAB APIs, so treat the enforcement picture as high-confidence-but-not-verified-in-register.

⚠️ Date note: You stated today is 26 April 2026, but my tooling header reads 29 September 2026, and my search results include events dated 30–31 August 2026. I report those events as found, flagged accordingly.

---

Bibliographic data (US 8,198,242 B2)

Abstract (verbatim substance)

"The present disclosure provides variants of C-type natriuretic peptide (CNP), pharmaceutical compositions comprising CNP variants, and methods of making CNP variants. The CNP variants are useful as therapeutic agents for the treatment of diseases responsive to CNP, including but not limited to bone-related disorders, such as skeletal dysplasias (e.g., achondroplasia), and vascular smooth muscle disorders (e.g., restenosis and arteriosclerosis)."

Plain-language overview of the independent claims

Claim 1 — Composition of matter (the closed Markush group). A CNP variant selected from six specific peptide sequences:

• SEQ ID NO:182 — QEHPNARKYKGANKKGLSKGCFGLKLDRIGSNSGLGC [CNP37(M32N)]
• SEQ ID NO:186 — PQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-CNP37)
• SEQ ID NO:192 — MQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Met-CNP37)
• SEQ ID NO:181 — GQEHPNARKYKGANKKGLSKGCFGLKLDRIGSNSGLGC [Gly-CNP37(M32N)]
• SEQ ID NO:145 — PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Pro-Gly-CNP37)
• SEQ ID NO:191 — MGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Met-Gly-CNP37)

In plain terms: this is a narrow, sequence-specific claim covering the two "M32N" analogs (Asn substituted at the position corresponding to Met32, i.e. Met17 of CNP-22, conferring NEP resistance) and their Pro-/Met-/Pro-Gly N-terminally extended forms — essentially Pro-Gly-CNP37 and near neighbors. It is not a genus claim to CNP variants generally.

Claim 4 — Method of treatment. Administering a claim-1 CNP variant to a subject to treat a bone-related disorder or skeletal dysplasia, specifically achondroplasia, wherein the administering treats achondroplasia. (Indication-limited to the single disease.)

Claim 5 — Recombinant production method. Culturing a host cell containing (a) a polynucleotide encoding a claim-1-type CNP variant polypeptide linked to (b) a polynucleotide encoding a cleavable peptide or protein (directly or via a linker), under conditions producing the fusion polypeptide. Claim 6 narrows the cleavable partner to a list including TAF12 (and its C/A and D/E mutants), KSI, MBP, β-galactosidase, GST, thioredoxin, chitin-binding domain and BMP-2 variants; claims 7–10 add bacterial host, soluble/inclusion-body expression, isolation, and chemical cleavage (formic acid, CNBr, hydroxylamine, self-cleavage, Factor Xa, enterokinase, ProTEV, SUMO protease). Claim 11/12 recites the method "which produces" Pro-Gly-CNP37.

Dependent claims 2–3 — a pharmaceutical composition comprising a claim-1 variant plus excipient/carrier/diluent, and a lyophilized formulation made from a citrate or acetate buffer at pH ~4–6.

---

Enforcement / litigation picture (2025–2026)

The '242 patent is the root of the asserted family, but the 2026 disputes center on its continuations/reissues, not on '242 itself:

• ITC Inv. No. 337-TA-1447 — Certain Drug Products Containing C-Type Natriuretic Peptide Variants; BioMarin asserted RE48,267 (the reissue whose parent chain runs through the '242 application 12/784,117) against Ascendis's TransCon CNP. Respondents included Ascendis, Bachem AG and Wacker Biotech GmbH.
• N.D. Cal. 4:25-cv-05696 (and predecessor 4:25-cv-03302) — Ascendis DJ action; discretionary stay granted 19 Sep 2025.
• CAFC No. 2026-1026 — Ascendis Pharma A/S v. BioMarin Pharmaceutical Inc., decided 26 Mar 2026 (Stoll, J., joined by Lourie and Chen). Precedential: affirmed denial of a mandatory § 1659(a)(2) stay, holding Ascendis could not reset the 30-day clock by voluntarily dismissing and refiling its DJ complaint ("prohibiting the use of voluntary dismissal to accomplish indirectly what cannot be accomplished directly"). Standing and collateral-order jurisdiction both upheld. This is the only 2026 CAFC decision in the CNP family I located — it addresses procedure, not the validity or scope of '242.
• PGR2026-00013 — Ascendis petition against BioMarin's U.S. 12,233,106 (a later CNP patent), overlapping with RE48,267 (e.g., claim 15). BioMarin's patent-owner preliminary response cites "Wendt-242" (Ex. 1023) as art already before the examiner — i.e., the '242 patent is being used as prior art, and its disclosure was previously considered by the examiner in that family.
• Global settlement, 30 Aug 2026 (per BioMarin 8-K/press release): Ascendis to pay BioMarin 20% of U.S. net sales and 18% in the EU, Brazil and South Korea of Yuviwel/navepegritide through May 2030; all pending proceedings (ITC §337, N.D. Cal., Brazil, Denmark, Germany, South Korea) to be dismissed, with a covenant not to challenge BioMarin's patent rights. This post-dates your stated date of 26 April 2026.

Confidence levels: Bibliographic data and claim text — high (consistent across Google Patents, Espacenet claims, DrugPatentWatch, and the corresponding WO 2010/135541/AU 2010249802 family documents). Litigation mapping — high for the existence and outcome of CAFC 26-1026; high that '242 itself is not the directly asserted patent in the 2025–26 proceedings, though I could not query the court registers directly.

Number-collision note (no auto-correction applied): A web result also lists "8198242" as an EMD part number for a flexible-coupling flange — an unrelated coincidence with no bearing on US 8,198,242.

I'll research litigation involving US patent 8198242. Let me search multiple sources.

The initial results mostly reference different patents with similar numbers (e.g., 9,816,824; 9,288,824; 7,877,824). Let me search more specifically.

Key findings emerging — BioMarin (owner of US 8,198,242) has been litigating CNP patents against Ascendis Pharma. Let me pin down the specific cases and whether the '242 patent itself was asserted.

Litigation Involving U.S. Patent No. 8,198,242

Bottom line

I could not identify any court or PTAB proceeding in which U.S. Patent No. 8,198,242 ("Variants of C-type natriuretic peptide," assignee BioMarin Pharmaceutical Inc.) is the patent-in-suit (i.e., directly asserted in an infringement complaint or challenged in a validity proceeding). However, the patent sits at the center of an active global patent war involving its owner's CNP franchise, and it appears in PTAB proceedings as a prior-art reference. Here is what is confirmed and what remains unverified.

---

1. Confirmed: Litigation in the '242 Patent Family (owner BioMarin vs. Ascendis Pharma)

Google Patents' page for US 8,198,242 expressly flags "Family has litigation" (Darts-IP first-worldwide-family-litigation link), meaning at least one member of this patent family has been litigated. The dispute is between the patent owner, BioMarin Pharmaceutical Inc., and Ascendis Pharma A/S concerning Ascendis's once-weekly CNP product Yuviwel / navepegritide (TransCon CNP), which competes with BioMarin's VOXZOGO (vosoritide).

Per BioMarin's August 30, 2026 announcement, the settled proceedings included:

Outcome: Global settlement announced August 30, 2026. Ascendis agreed to pay BioMarin a 20% royalty on U.S. net sales (retroactive to first commercial sale) and 18% on EU, Brazil, and South Korea net sales through May 2030, with a worldwide license to BioMarin's CNP patents covering Yuviwel (achondroplasia and hypochondroplasia). Sources: BioMarin investor release (investors.biomarin.com, Aug. 30, 2026); allsci.com; Nasdaq.com.

Critical caveat: The public reporting and the press release describe the asserted patents only generally as "BioMarin's patents that relate to Yuviwel" / "patents covering CNP analogs." I could not confirm from the available search results that U.S. 8,198,242 specifically was named in the ITC complaint or the N.D. Cal. complaint. Given that BioMarin holds a portfolio of related CNP patents (e.g., U.S. 8,377,884; 8,598,121; 12,233,106 — several of which are in the '242 family), it is plausible but not established that '242 was among the asserted patents. I could not retrieve the ITC investigation number or the N.D. Cal. case docket number before exhausting my search steps.

---

2. Confirmed: The '242 Patent as Prior Art in PTAB Proceedings

U.S. 8,198,242 is cited as the "Wendt-242" prior-art reference in post-grant proceedings challenging BioMarin's later patent U.S. 12,233,106 (Methods of Treating Skeletal Dysplasia):

• PGR2026-00013 — Ascendis Pharma A/S v. BioMarin Pharmaceutical Inc., Petitioner Ascendis Pharma A/S, Patent Owner BioMarin, challenging U.S. 12,233,106. Ground 2 asserts anticipation "by Wendt-242 (Patent 8,198,242)."
• PGR2026-00055 — Zydus Pharmaceuticals USA Inc. v. BioMarin Pharmaceutical Inc. (petitioners also include Zydus Lifesciences Limited and Zydus Lifesciences Global FZE), filed June 5, 2026, challenging U.S. 12,233,106, claims 1–14. Ground 2 again relies on "Wendt-242 (Patent 8,198,242)" as anticipatory prior art.

In these proceedings, '242 is not itself under challenge — it is the sword used against a junior BioMarin patent. This is significant for '242's litigation posture: it functions as blocking prior art supporting BioMarin's earlier priority position.

Sources: ptacts.uspto.gov petitions (PGR2026-00013, PGR2026-00055 filings); ai-lab.exparte.com case summaries.

---

Summary Table

---

Professional caveats / recommendations

1. No direct '242 assertion confirmed. I found no complaint, ITC notice, or court docket affirmatively naming U.S. 8,198,242 as an asserted claim. To definitively determine whether '242 was asserted, please pull: (a) the ITC Section 337 complaint and notice of investigation (search ITC EDIS by "Ascendis" / "navepegritide"), and (b) the N.D. Cal. complaint under BioMarin Pharmaceutical Inc. v. Ascendis Pharma A/S. Neither docket number was retrievable within my search limit.
2. Verify before relying. Two results returned similar but different patent numbers (9,816,824; 9,288,824; 7,877,824) that are unrelated to this inquiry. I have excluded them. I have also flagged search results referencing equipment part numbers ("8198242 FLANGE") in an EMD coupling catalog — these are not the patent and were disregarded.
3. No CAFC appeal identified involving '242 specifically.

If you need me to attempt retrieval of the ITC investigation number and the N.D. Cal. docket, or to check the '242 file wrapper/IEEE/Unified Patents litigation registry directly, I can do so with a fresh search budget.

I'll verify the structured PTAB block with live searches before concluding, since the ODP ingest may lag recent filings.

Let me confirm the absence of AIA trials naming '242 itself and check the family's reissues for contrast.

One more verification pass — whether any AIA trial touched the reissues/continuations in the '242 family, and the D.N.J. case that appears associated with '242.

PTAB / AIA Trial Analysis — U.S. Patent No. 8,198,242

Verification note (2026-09-29): The structured "PTAB proceedings on file" block for US 8,198,242 is empty. I ran four live searches (Google Patents/PTAB petition documents, PTAB E2E-derived mirrors, DrugPatentWatch litigation and PTAB pages, and Federal Circuit/board decision lists) and found nothing that displaces that result. The findings below therefore answer the task by confirming the absence and explaining what that absence means — while flagging two items in the earlier-generated sections that need updating.

---

Proceedings overview

There are zero (0) AIA trial proceedings — IPR, PGR, or CBM — naming U.S. Patent No. 8,198,242 as the challenged patent, in any status: none active, none invalidated, none sustained, none settled, no institution denials.

Bottom-line defensive posture: the patent is completely untested at the PTAB. It is not "hardened" — it is unexercised. Because no petitioner has ever filed against it, there is no § 315(e)(2) estoppel attaching to any ground, no FWD to cite, and no claim of '242 that has been adopted, narrowed, or cancelled by the Board. For a defendant receiving a demand letter citing '242 today, the PTAB door is wide open (subject to the § 315(b) one-year service bar and § 315(a) DJ bar below). The absence of IPRs is not evidence that the patent is strong — it is largely explained by the fact that the asserted fight in 2025–26 was litigated over junior family members and the 2025-vintage U.S. 12,233,106, not over this 2012 patent.

---

No proceedings to report — and here is why

The required per-proceeding format cannot be populated because no {PROCEEDING_NUMBER} exists. I will not manufacture one. Instead, here is the accurate picture of where '242 does appear in PTAB records, clearly labeled.

'242 in PTAB: prior art, not target

PGR2026-00013 — Ascendis Pharma A/S v. BioMarin Pharmaceutical Inc.

• Patent challenged: U.S. 12,233,106 B2 — not '242.
• Role of '242: cited as "Wendt-242" (Ex. 1023). Under Ground 2, petitioner argues that Wendt-242 (i.e., U.S. 8,198,242) anticipates the '106 claims, relying on Example 19 of '242 (treatment of humans from "infant[s] (<1 year of age) to pre-adolescent (<13 years of age)") and on '242's express disclosure of Pro-Gly-wtCNP37 (= the Pro-Gly-CNP37 recited in '106 claim 1). See the petition/patent-owner papers at ptacts.uspto.gov petition 1558718.
• Status signal: The Director's consolidated notice on institution places PGR2026-00013 in the group that "will be reviewed for merits and non-discretionary considerations" — i.e., it was not denied on discretionary grounds — while listing PGR2026-00010 and PGR2026-00011 as denied on the merits. Treat "instituted" as likely but confirm at PTAB E2E.

PGR2026-00055 — Zydus Pharmaceuticals USA Inc. v. BioMarin Pharmaceutical Inc.

• Filed: 2026-06-05. Patent challenged: U.S. 12,233,106, claims 1–14 — not '242.
• Role of '242: again "Wendt-242 (Patent 8,198,242)" as Ground 2 (anticipation) against claims 1–7 and 9–14. Case summary: ai-lab.exparte.com/case/ptab/PGR2026-00055.

Defensive-value read of these two: '242 is BioMarin's priority shield, functioning as § 102 art that BioMarin's own adversaries use to attack a later patent. That is a signal of the '242 disclosure's breadth and of its early priority — not of its invalidity. It also means the '242 specification is now heavily scrutinized in public filings, which a future '242 petitioner could mine for § 112 arguments (the '106 attack includes a § 112(a) enablement ground built on the "enormous scope" theory, per the PGR2026-00055 summary). That reasoning transfers imperfectly to '242, whose claim 1 is a six-sequence closed Markush rather than a 65-member genus.

---

⚠️ Contradictions / updates to the previously-generated sections

Per my instruction to flag conflicts explicitly:

1. Possible direct assertion of '242 — the earlier "Litigation summary" said none could be confirmed; there is now a partial signal the other way. DrugPatentWatch's patent-specific litigation page for 8,198,242 lists it in two district court matters: (i) Ascendis Pharma A/S v. BioMarin Pharmaceutical Inc., N.D. Cal., 28:2201 declaratory judgment, filed 2025-07-07, terminated 2025-09-09 (the DJ action later at issue in CAFC No. 2026-1026, Ascendis v. BioMarin, decided 2026-03-26); and (ii) a 35:271 patent-infringement ANDA case in D.N.J. filed 2026-02-02 — which is BioMarin Pharmaceutical Inc. v. Zydus Lifesciences Ltd., No. 1:26-cv-01005 (D.N.J.), Chief Judge Renee Marie Bumb. Caveat: the AI-generated complaint analysis for that case identifies the '106 patent as the Paragraph IV patent-in-suit and states that Zydus filed Paragraph III certifications (no-challenge-until-expiry) for other Orange Book-listed patents. So '242 is most likely named in the complaint as an OB-listed patent subject to a Paragraph III certification, not the Paragraph IV target. This is a refinement, not a clean contradiction, but it changes the earlier flat statement that no '242 assertion is confirmed. Verify against the docket (PACERMonitor case 62932629) and BioMarin's Orange Book listing.

2. Expiration-date discrepancy. Google Patents lists '242's adjusted expiration as 2030-06-11; the D.N.J. complaint analysis timeline recites "2035-06-11 — U.S. Patent No. 8,198,242 Expiration Date" (consistent with a patent-term extension and/or the reissue overlay). These cannot both be right. For a defendant this matters enormously (5 years of exposure). Pull the face of the patent / Patent Term Extension certificate and the Orange Book listing.

3. Reissue posture is unresolved and material to any PTAB strategy. The earlier section states the family includes RE46,707 and RE48,267, and that RE48,267's chain runs through application 12/784,117 — the '242 application. If '242 was itself surrendered by reissue under 35 U.S.C. § 252, then a defendant's real target is the reissue, not the original patent, and the Google Patents "Active" flag is misleading. I could not resolve this within my search budget, and I found no IPR/PGR against RE48,267 or RE46,707 either. Confirm which document is in force before drafting any petition.

4. Date inconsistency (inherited). The earlier sections carry a note that the user stated 26 April 2026 while tooling reads 29 September 2026. The current task prompt does not restate a date; I have used 2026-09-29 throughout and report the 2026-08-30 BioMarin/Ascendis settlement as a post-date event relative to the stated user date.

---

Strategic summary

Claim status of '242: UNTESTED in its entirety. Claims 1–12 (composition of matter, pharmaceutical composition, lyophilized formulation, achondroplasia treatment method, and the TAF12/KSI/TrxB/BMP-2 recombinant-production method claims) have never been construed, instituted, or adjudicated by the Board. There are no canceled claims and no sustained claims. If a demand letter asserts claims 1–5, a defendant cannot point to any FWD showing the claims are dead — but neither can BioMarin point to any appellate affirmance validating them.

Estoppel landscape: There is no § 315(e)(2) estoppel with respect to '242, because there has been no '242 IPR/PGR. Grounds previously raised by Ascendis or Zydus in their '106 PGRs do not estop them from raising the same art against '242 — estoppel is patent-specific. Two real bars remain for any defendant: (a) § 315(b) — a petition filed more than one year after service of a complaint alleging infringement of '242 is time-barred (docket the service date); and (b) § 315(a)(1) — a petitioner that previously filed a DJ action of invalidity on '242 cannot later petition (this is precisely the posture that produced the N.D. Cal. dismissal and the CAFC's 2026-03-26 ruling on voluntary dismissal and the § 1659 stay clock). Separately, Ascendis is contractually barred: the 2026-08-30 settlement term sheet includes a covenant by Ascendis not to challenge BioMarin's patent rights, with all pending proceedings dismissed with prejudice.

Pattern signals: No repeat petitioner against '242 (zero petitions). No PTAB appeals on '242. No defensive aggregator (Unified Patents or similar) appears anywhere in the '242 chain. The only AIA activity in the neighborhood is petitioner-side work by Ascendis and Zydus directed at the junior '106 patent — and both use '242 as anticipatory art. BioMarin's own PTAB track record is as a petitioner (the Genzyme/Duke Pompe cases), not as a '242 patent owner defending an AIA trial.

---

Recommended next steps

1. If you are a defendant receiving a '242 demand: you have a clean runway to file an IPR/PGR — no estoppel, no FWD adverse to your position, no prior panel findings to overcome. But docket the service date immediately (§ 315(b) 18-month/1-year clock) and confirm you have not filed a DJ on '242 (§ 315(a)(1)). Because '242 issued from an application filed 2010-05-20 (pre-AIA), a PGR is unavailable (PGR applies only to patents with an effective filing date on or after 2014-03-16); your vehicle is IPR.
2. Before drafting, resolve the reissue question. Confirm at USPTO PatentCenter whether US 8,198,242 remains in force or has been surrendered by RE46,707 / RE48,267. Petition the correct document. No IPR has ever been filed against any of these three, so family IPR activity is not a constraint in either direction.
3. Mine the PGR2026-00013 / PGR2026-00055 records for § 112 and secondary-consideration material. Both petitions contain detailed evidentiary exhibits about Pro-Gly-CNP37 (= vosoritide, the very peptide recited in '242 claim 1 as SEQ ID NO:145) and its prior disclosure (e.g., Ex. 1053, the 2012 large-scale PG-CNP37 production paper). Those exhibits are a ready-made lead set for an IPR obviousness theory against '242's Markush claims.
4. Monitor the family, not '242, for board movement. The live AIA exposure sits on U.S. 12,233,106 (PGR2026-00013 — status per Director's notice: merits review, FWD projected ~June 2027 per petitioner's own Filing; and PGR2026-00055). Watch whether institution of PGR2026-00013 is confirmed and whether BioMarin's POPR arguments (inconsistent claim construction across forums, unnamed RPIs Bachem AG and Wacker Biotech GmbH, § 325(d)) carry. Tracking links:
   • PTAB petition record (PGR2026-00013): https://ptacts.uspto.gov/ptacts/public-informations/petitions/1558718/download-documents
   • Case summary (PGR2026-00055): https://ai-lab.exparte.com/case/ptab/PGR2026-00055/doc/1064
   • Patent-specific litigation listing for '242: https://www.drugpatentwatch.com/p/litigation/patent/8198242
   • D.N.J. ANDA docket: https://www.pacermonitor.com/public/case/62932629/BIOMARIN_PHARMACEUTICAL_INC_v_ZYDUS_LIFESCIENCES_LIMITED_et_al
   • Company PTAB E2E: https://ptacts.uspto.gov (search "8,198,242" and "RE48,267")
5. Do not rely on the '106 PGR outcomes as precedent for '242. '106 claim 1 is a 65-member Markush method claim asserted for a narrow infant age range; '242 claim 1 is a six-sequence closed Markush with a companion recombinant-production claim. The enablement and written-description attacks that are strong against '106 do not map cleanly onto '242 — a § 102/§ 103 attack on the specific SEQ ID NOs:145/181/182/186/191/192 and on the TAF12-cleavage production method is the more promising path.

Confidence: High that there are no AIA trials on U.S. 8,198,242 — the USPTO ODP block and four independent searches agree. Medium on the filing/status details of PGR2026-00013 (I could read the petition and POPR texts and the Director's institution notice, but not a clean institution decision PDF). Low–medium on the reissue-in-force question and on whether '242 was named as anything other than an OB-listed Paragraph III patent in BioMarin v. Zydus; both need register-level confirmation.

I'll research the assignment/ownership record for US 8,198,242. Let me search multiple sources.

Let me search for the specific USPTO assignment record details (reel/frame) and any subsequent transfers.

The searches aren't surfacing the reel/frame. Let me try more targeted queries, including the assignment center and any security interests or later transfers.

Ownership & Assignment Reconstruction — US Patent 8,198,242

⚠️ Source-availability caveat (read first)

I attempted to query the USPTO Assignment Center (assignmentcenter.uspto.gov / assignment.uspto.gov/patent/index.html) and its public mirrors. I was unable to retrieve the reel/frame, execution date, or recorded-correspondent fields for this patent's assignment record. The USPTO Assignment Search is a JavaScript application whose records are not fully exposed to general web indexing, and I exhausted my search budget before reaching a record view.

What I can confirm is the existence, date, parties, and conveyance type of the sole recorded assignment, via the Google Patents legal-events mirror, which reproduces the Assignment Center data. I flag every field I could not verify rather than inferring it.

Date reconciliation with prior sections: the header for this task reads 2026-09-29. The earlier Patent summary flagged a discrepancy (user-stated 26 April 2026 vs. tooling 29 September 2026). I proceed on 2026-09-29.

---

Inventors

All seven named inventors, with their residence of record on the pre-grant publication US 2010/0297021 A1:

Basis for employer: each inventor executed an assignment of their interest to BioMarin Pharmaceutical Inc. (recorded 2010-10-05, per the Google Patents legal-events mirror), and the application's correspondence address of record is "Marshall, Gerstein & Borun LLP (Biomarin), 233 South Wacker Drive, 6300 Willis Tower, Chicago, IL 60606" — i.e., BioMarin's outside counsel. All inventor residences are in the San Francisco Bay Area, consistent with BioMarin's Novato, CA headquarters.

Pattern note — no mass-departure / fire-sale precursor observed. The same seven inventors are named on later members of the same family, including the 2016-filed US 2017/0051033 A1 (same seven names). Long-tenure inventor continuity on family filings points away from the "all inventors depart the original assignee within 12 months of filing" pattern that precedes a portfolio fire-sale. One inventor (Price) later lists a foreign residence (Aachen, DE) on the 2017 publication — a personal relocation, not evidence of a portfolio event. No inventor-departure data was found in SEC filings within my search budget.

Incidental claim-3 link: inventor Okhamafe is listed on BioMarin formulation work; claim 3 (lyophilized citrate/acetate buffer, pH 4–6) is consistent with a formulation-scientist co-inventor. Offered as context only, not as an ownership finding.

---

Original assignee

BioMarin Pharmaceutical Inc., Novato, CA — the entity named on the face of the issued patent (73) Assignee, and also the recorded assignee under the 2010-10-05 recording. There is no "original assignee" separate from the current owner on this patent.

• Primary line of business: commercial-stage biopharmaceutical company; developer and manufacturer of enzyme replacement and peptide therapeutics (e.g., Naglazyme, Aldurazyme, Kuvan, Palynziq, Vimizim). Publicly traded (NASDAQ: BMRN).
• Did it ship a product embodying the claims? Yes — VOXZOGO (vosoritide), an FDA-approved modified CNP analog for achondroplasia. DrugPatentWatch lists the family reissue RE48,267 as protecting VOXZOGO and as "included in one NDA." Vosoritide is the CNP-analog franchise to which this application's disclosure (CNP-37/CNP-38 constructs, Pro-Gly-CNP37) directly relates per the specification and FIGs. 15, 19, 23, 44 and 49–63 of the '242 text.
• Current status: Operating. No Chapter 7/11, no dissolution, no assignment to a liquidating trust found. BioMarin remained the named patent owner / "Applicant" on the family reissues RE46,707 and RE48,267 and on the 2024–2026 filings, per the family documents.

---

Assignment timeline

Confirmed records for US 8,198,242 (application 12/784,117):

• Execution date: NOT RETRIEVED / recorded 2010-10-05
  • Reel NOT RETRIEVED / Frame NOT RETRIEVED (the Assignment Center record view was not reachable within budget; Google Patents legal events reproduce the record but omit the reel/frame)
  • Conveyance: Assignment of Assignors Interest (see document for details) — i.e., an inventor-to-company assignment, not a name change, merger, security interest, or license.
  • Assignor: WENDT, DANIEL J; VELLARD, MICHEL CLAUDE; AOYAGI-SCHARBER, MIKA; PRICE, CHRISTOPHER P; CASTILLO, SIANNA; LONG, SHINONG; OKHAMAFE, AUGUSTUS O. (all seven named inventors, jointly)
  • Assignee: BIOMARIN PHARMACEUTICAL INC.
  • Correspondent: NOT RETRIEVED from the assignment record. The prosecution correspondent of record across the family is Marshall, Gerstein & Borun LLP (Biomarin), 233 South Wacker Drive, 6300 Willis Tower, Chicago, IL 60606. I do not conflate these two fields; the assignment-record correspondent may differ and was not verified.
  • Context: Initial inventor assignment to the operating-company employer — the standard "hereby assign all right, title and interest" filing executed as a condition of employment. One sentence: routine first-link-in-chain acquisition by the operating company, ~20 months before issuance.

Post-issuance assignments to US 8,198,242:

None found. The Google Patents legal-events timeline for US 8,198,242 shows only the 2010-05-20 filing event, the 2010-10-05 inventor assignment, and the 2012-06-12 grant. There is no later Assignment, Security Agreement, Merger, Change of Name, License, Release, or Correction recorded against this patent. Current assignee is still listed as BioMarin Pharmaceutical Inc. (both "Original Assignee" and "Current Assignee" fields).

Related family events (NOT assignments of the '242 patent — shown for chain-of-title context only):

Each of these is a same-owner, same-family filing (BioMarin Pharmaceutical Inc. as applicant/assignee throughout), not a transfer. None is a recorded conveyance to a different entity.

Maintenance / status: Google Patents lists "Active, expires 2030-06-11" (adjusted expiration). No fee-lapse or expiration-for-nonpayment event appears in the legal-events mirror.

---

Timeline diagram

timeline
    title Ownership of US 8198242
    2009 : Priority provisionals filed
    2010 : Application filed by BioMarin
         : Inventors assign rights to BioMarin
    2012 : Patent US 8198242 issues
    2015 : Reissue RE46707 filed by BioMarin
    2017 : Reissue RE48267 filed by BioMarin
    2021 : VOXZOGO vosoritide approved
    2025 : BioMarin sues Ascendis at ITC and ND Cal
    2026 : Global settlement with Ascendis

(The 2025/2026 terminating events relate to the family; per the earlier sections they are directed at RE48,267 and later CNP patents, not at US 8,198,242 itself.)

---

NPE / troll-pattern signals

1. Shell-entity transfer — NOT PRESENT.
The only recorded conveyance runs inventors → BioMarin Pharmaceutical Inc. (recorded 2010-10-05). No assignee with an "IP / Patents / Licensing / Holdings / Ventures" suffix appears anywhere in the chain. No single-purpose Delaware/Texas LLC, no registered-agent service address, no post-issuance transfer at all. The assignee is a NASDAQ-listed operating manufacturer with marketed products.

2. Known asserter in the chain — NOT PRESENT.
Current assignee BioMarin Pharmaceutical Inc. matches none of the listed NPE directories (Acacia, Marathon, IV, IPNav, Wi-LAN, Conversant/Mosaid, Vringo, Pendrell, Innovatio, MPHJ, Lumen View, Round Rock, Document Generation Corp, Spangenberg entities), nor does any entity surfaced by Unified Patents/RPX appear in the chain — because there is no downstream chain at all. BioMarin is the defendant-side target of NPE/junior-patent challenges, not an NPE: it is the patent owner resisting Ascendis in PGR2026-00013 and resisting Zydus in PGR2026-00055, and it is the complainant/plaintiff in the 2025 ITC and N.D. Cal. actions. Inverted signal of interest: in those PGRs, the '242 patent is cited by petitioners as prior art ("Wendt-242") against BioMarin's own junior patent US 12,233,106 — i.e., '242 functions as a blocking reference held by an operating company, the opposite of an NPE monetization posture.

3. Repeat correspondent across the chain — UNCLEAR (insufficient data), leaning not-present.
I could not retrieve the assignment-record correspondent, so I cannot test recurrence on the chain itself. The prosecution correspondent recurs across all family members — Marshall, Gerstein & Borun LLP (Biomarin), Chicago, IL — appearing on US 2010/0297021 A1, US 2012/0316114 A1, RE46,707, and US 2017/0051033 A1. That recurrence is exactly what one expects from a single operating-company owner's outside counsel maintaining one family, and Marshall Gerstein is a large general-practice IP firm (not a known NPE-recording agent). I flag the recurrence to be thorough but do not treat it as a finding. Other family documents list Finnegan commentary but no Finnegan correspondent on this chain.

4. Cascading transfers — NOT PRESENT.
Zero consecutive assignments. There is one link (inventor → BioMarin) in the entire 16-year life of the patent. No chained LLCs, no <24-month multi-hop sequence, no shared correspondent addresses among multiple assignees (there is only one assignee).

5. Pre-litigation transfer — NOT PRESENT.
The sole assignment is dated/recorded 2010-10-05, roughly 20 months before issuance (2012-06-12) and roughly 15 years before the 2025 infringement actions. It is not within 6 months of any suit naming this patent, and no suit naming '242 was identified in the prior sections. There is no transfer arranged to set venue or manufacture standing.

6. Bankruptcy fire-sale — NOT PRESENT.
No Chapter 7/11 of BioMarin, and no sale-of-portfolio event (no Kodak/Nortel/Polaroid-style transaction). BioMarin remained the applicant on family reissues filed 2015 and 2017 and on 2020s filings.

7. Privateering — NOT PRESENT (documented inverse).
BioMarin asserts in its own name — as complainant before the ITC (Inv. No. 337-TA-1447, Certain Drug Products Containing C-Type Natriuretic Peptide Variants) and as plaintiff in N.D. Cal. — against a direct commercial competitor, Ascendis Pharma, over its competing CNP product navepegritide/TransCon CNP. There is no transfer to a proxy NPE. The 2026 resolution is a paid-up license taken by the infringer (Ascendis, ~20% of US net sales; 18% of EU/Brazil/South Korea net sales through May 2030), not a transfer of title to an aggregator or troll. Note: no license recording for this settlement was found in the USPTO assignment records for '242, and licenses are frequently not recorded — I flag that as an absence of evidence, not evidence of absence.

8. Defensive aggregator — NOT PRESENT.
The chain does not terminate at RPX, AST, LOT Network, Unified Patents, or OIN. It terminates (and terminates where it began) at an operating company, BioMarin.

---

Verdict

Operating-company assertion.

Justification. The entire recorded chain consists of a single link — the seven named inventors assigning to BioMarin Pharmaceutical Inc., recorded 2010-10-05 as an "Assignment of Assignors Interest" (reel/frame not retrieved) — and Google Patents shows no post-issuance assignment, security interest, or transfer against US 8,198,242, with BioMarin still listed as current assignee. BioMarin is a NASDAQ-listed operating manufacturer that ships a product in the claimed space (VOXZOGO/vosoritide) and litigates in its own name against a genuine commercial competitor (Ascendis, ITC 337-TA-1447 and N.D. Cal.), settling in 2026 for a royalty rather than transferring title. Not one of the eight NPE signals is present on the evidence available; the only nuance is a recurring prosecution correspondent (Marshall, Gerstein & Borun (Biomarin)) that reflects ordinary single-owner family maintenance rather than NPE repeated filing.

Residual uncertainty (do not rely without verification). Because I could not open the Assignment Center record, the reel/frame, executed date, and recorded correspondent for the 2010-10-05 recording remain unverified, as does whether the recording bundled additional BioMarin properties (e.g., provisionals 61/180,112 and 61/254,563 or PCT/US2010/035586). A one-record chain is the expected profile of an operating-company-owned patent and would not be disturbed by those fields — but they should be pulled from the primary source before any formal reliance.

Verification links:

• USPTO Assignment Center (search by patent 8198242): https://assignmentcenter.uspto.gov/
• Legacy Assignments on the Web: https://assignment.uspto.gov/patent/index.html
• Google Patents legal events for this patent: https://patents.google.com/patent/US8198242/en (see "Assigned to BIOMARIN PHARMACEUTICAL INC — 2010-10-05")

No auto-correction applied: web results repeatedly return unrelated "8198242 FLANGE" entries (EMD flexible-coupling parts catalog). These were disregarded and have no bearing on US 8,198,242.

I'll research the prior-art references cited on the face of US 8,198,242. Let me run several targeted searches.

I have the patent text and some reference lists. Let me pull the actual front-page patent citations and the academic prior art from the Justia/PubChem records.

I now have the complete front-page citation list from the PubChem patent record. Let me verify titles and dates for the key references before analyzing them.

Prior Art Analysis — U.S. Patent No. 8,198,242 ("Variants of C-type natriuretic peptide")

Scope note / method. I pulled the consolidated "References Cited" list for U.S. 8,198,242 from its PubChem patent record (which mirrors the printed front page and Google Patents' citation data), cross-checked against the corresponding EP family member's "References cited in the description" list. Because the application was filed 20 May 2010 with priority to 20 May 2009 (both before 16 March 2013), pre‑AIA 35 U.S.C. §§ 102(a)/(b)/(e) and 103(a) apply.

⚠️ Two caveats before the table:

1. I hit my search-step limit while verifying individual bibliographic entries. Items marked [verified] were confirmed in the fetched sources; items marked [date unverified] are from my own recollection and must be re-checked in PatentCenter/Espacenet before being relied upon — I have deliberately not invented exact days for them.
2. The list below is the citation list on the face of the patent (applicant/IDS + examiner references combined). It is not the same thing as the examiner's actual §102 rejections, which live in the file wrapper and which I could not retrieve.

---

A. References expressly discussed in the '242 background (the closest "state of the art" statements)

These four are the references the specification itself characterizes as prior approaches, so they are the most probative §102/§103 art on the concept level:

---

B. Remaining cited patent documents

---

C. Key non‑patent literature cited (selected; the '242 record lists ~100 NPL items)

• Sudoh et al., Biochem. Biophys. Res. Commun. 168:863–870 (1990) — first description of CNP‑22. [verified] → CNP‑22 backbone art (same relevance as B1).
• Kenny et al., Biochem. J. 291(Pt 1):83–88 (1993) — NEP (endopeptidase‑24.11) hydrolyzes CNP. [verified] → the motivation for the NEP‑resistance feature of claim 1, but not the sequences.
• Oefner et al., J. Mol. Biol. 296:341–349 (2000) — NEP active‑site structure, size limitation. [verified] → rationale art.
• Koller et al., Science 252:120–123 (1991); Nakao et al., J. Hypertens. 10:907‑912 & 1111‑1114 (1992); Maack et al., Science 238:675–678 (1987) — CNP/NPR‑B/NPR‑C biology. [verified]
• Chusho et al., PNAS 98:4016–4021 (2001) — CNP‑knockout dwarfism; Yasoda et al., Nat. Med. 10:80–86 (2004) — CNP overexpression rescues achondroplasia. [verified] → motivation for claim 4, but not anticipation.
• Krejci et al., J. Cell Sci. 118:5089–5100 (2005); Yamashita et al., J. Biochem. 127:177–179 (2000); Wu et al., J. Biol. Chem. 278:25847–852 (2003) (furin processing of pro‑CNP); Schiller et al., BBRC 138:880–886 (1986) (CNP‑17 ring required for NPR‑B binding). [verified]

---

D. §102 bottom line, claim by claim

• Claim 1 (six‑member sequence Markush: SEQ ID NO:182, 186, 192, 181, 145, 191). No cited reference is known to anticipate this claim. Every cited reference is either (i) a CNP‑22/CNP‑53/pro‑CNP backbone disclosure (B1, B2, B13, B14), (ii) an analog or chimera disclosure at different positions/residues (A3, B5), (iii) a conjugation/chemistry reference (A4, B15, B16), or (iv) a method‑of‑use reference (B6, B7, B8). None is known to disclose the combination of (a) the CNP‑37 N‑terminal extension and (b) the M32N substitution — the features that define the claim. The only genuine §102 candidate is B12, WO 2009/067639 A2, and only if it (1) discloses a species within the claim and (2) survives the "by another" / common‑ownership analysis.
• Claims 2–3 (pharmaceutical/lyophilized compositions). No cited reference discloses the specific claim‑1 variants; a composition claim takes the novelty of its active ingredient → no anticipation.
• Claim 4 (achondroplasia treatment). B6/B7 (Nakao CNP‑for‑bone art) and the NPL (Chusho, Yasoda) establish the indication, but claim 4 is limited to administering a claim‑1 variant → no anticipation.
• Claims 5–12 (recombinant production with a cleavable fusion partner; formic‑acid cleavage; "which produces Pro‑Gly‑CNP37"). The cited list contains no reference to TAF12 (or its C/A, D/E mutants), KSI, MBP, BMP‑2 variants, or Asp‑Pro/formic‑acid cleavage of a CNP fusion. The only tangentially relevant citations are general protein‑PEGylation chemistry (B15, B16), which are not on point → no anticipation.
• Claim 13 (lyophilization additives). No anticipation.

Provisional conclusion: the cited art is overwhelmingly §103 background (CNP biology, NEP susceptibility, NPR‑C clearance, PEGylation, bone‑growth indication). The claim‑1 sequences appear novel over the entire cited list, with WO 2009/067639 A2 the sole reference warranting a file‑wrapper check as a possible §102(e) reference — and even then its status turns on the common‑ownership/inventive‑entity question.

---

E. Explicit caveats and what to verify next

1. I could not retrieve the '242 file wrapper (examiner's PTO‑892 citations, actual §102 rejections, and any 37 CFR 1.131/1.132 declarations). Everything above is derived from the printed citation list, not from the examiner's grounds of rejection.
2. Numerous individual dates/titles are marked "[date unverified]" because I exhausted my search budget mid‑verification. Do not cite those as confirmed. The verified entries are B1 (US 5,352,770), B2 (US 6,034,231), B12 (WO 2009/067639 family data), and the NPL items flagged [verified].
3. Number‑collision control: as flagged in the earlier sections, the EMD catalog part number "8198242" (a flexible‑coupling flange in the MPC‑1210 manual) is an unrelated coincidence and has been excluded from this analysis, per the instruction not to auto‑correct identifiers and to return only results for the patent number.
4. No anticipation should be treated as an affirmative legal conclusion. It is my analysis of whether each reference discloses every element of a claim. For the closest references (A3, B5, B12), a formal element‑by‑element comparison against the six SEQ ID NOs is the appropriate next step.

I'll research the prior art landscape for the '242 claims before building the §103 analysis.

Excellent — the searches surfaced specific prior-art references. Let me pin down dates and disclosures for the most important ones.

Obviousness Analysis — U.S. Patent No. 8,198,242 under 35 U.S.C. § 103

0. Scope, sources, and legal framework

What "the Prior Art section of this page" gave me. The Google Patents record for US 8,198,242 does not carry a discrete "References Cited" block in the fetched text; what it does carry is (a) an extensive Definitions/Background section that cites specific prior-art documents by name, (b) a "Prior art keywords" field (cnp, seq, gly, cnp22, cnp37), and (c) "Non-Patent Citations" surfaced through sibling family members (e.g. US9962429B2, EP1743653A1). I have supplemented those with third-party art that the background itself characterises and with art surfaced in the 2026 PTAB filings that quote the same body of work (e.g. the PGR2026-00013 petition exhibits at ptacts.uspto.gov). Claim text is taken from the Espacenet claims view.

Legal framework. The application was filed 20 May 2010 with earliest priority 20 May 2009 — pre-AIA §§ 102/103 govern. Obviousness is assessed under Graham v. John Deere, 383 U.S. 1 (1966), as refined by KSR Int'l Co. v. Teleflex Inc., 550 U.S. 398 (2007): predictable variations, "obvious to try" within a finite set of identified solutions, and combination of known elements according to known methods are all obvious absent unexpected results.

⚠️ Cross-reference / consistency flag. The previously generated sections noted a dating discrepancy (stated date 26 April 2026 vs. tooling date 29 September 2026) and a global settlement dated 30 Aug 2026. That discrepancy persists here; it does not affect this § 103 analysis, because every reference below is dated 1983–2009 and none of the 2025–26 PGR/ITC materials are cited as prior art against '242 — they are cited only as evidence of what the art landscape contained.

---

1. The prior art of record

Note on PA-2 dates. US 2008/0194682 A1 (pub. 14 Aug 2008) is unambiguously a printed publication before the 20 May 2009 priority date. The verbatim Met17-Substitution passage I quote is reproduced from later family members; because continuations cannot add new matter, the passage is presumptively original disclosure, but I could not open the 2008 publication's full text within my search budget. This should be verified against US 2008/0194682 A1 (and the corresponding WO) before the argument is relied upon. Flagged as medium confidence; if the passage is not in the 2008 publication, PA-2 shifts to a 2009–2010 publication date and becomes unusable against the 20 May 2009 priority.

---

2. Claim 1 — element-by-element

Claim 1 is a closed Markush of six species. Structurally they reduce to three independent variables:

• (A) the backbone — QEHPNARKYKGANKK-CNP22 ("CNP37"), a known, naturally occurring CNP form (PA-6, PA-12, PA-13);
• (B) Gly32→Asn (i.e. CNP22 Met17→Asn) — present in SEQ ID 182 and 181 only;
• (C) an N-terminal di/tri-peptide cap — Pro-, Met-, Pro-Gly-, Met-Gly- (SEQ 186, 192, 145, 191) or Gly- (SEQ 181).

2.1 Variable (A) — the CNP37 backbone

CNP-37 is a natural circulating CNP form that pre-dates the filing by nearly two decades (PA-13). PA-7 expressly teaches that extending CNP to the CNP-53 length does not change NPR-B binding or cGMP dose-response. PA-4 supplies the reason to go longer: NEP cannot process substrates above ~3 kDa, and CNP22 (2.2 kDa) is below that line while CNP37 (~4.0 kDa) is above it. PA-8 supplies the reassurance that anything outside the Cys6–Cys22 ring is pharmacologically dispensable. Selection of the CNP37 backbone is therefore the single most obvious choice available to a POSA.

2.2 Variable (B) — Met32→Asn

Combination: PA-2 + PA-3 + PA-5 + PA-4.

• PA-5 establishes that Ser16–Met17 is a discrete NEP scissile bond.
• PA-2 expressly instructs: "Met 17 is a site of NEP cleavage and its substitution by another amino acid … increases activity and may increase stability," and then supplies a working list — Ala, Trp, His, Lys, Ser, Gly — spanning small/hydrophobic (Ala, Gly), aromatic (Trp), basic (His, Lys) and polar (Ser) chemistry.
• PA-3 independently confirms that position-17/18 mutants retain full NPR-B potency.
• PA-4 confirms that blocking this bond is worth doing.

A POSA reading PA-2 is taught (i) which residue to change, (ii) why (removal of an NEP P1' recognition determinant), and (iii) that residues of wildly different physicochemical class all succeed. That last point is decisive against any argument that the art taught away from non-hydrophobic replacements: the art's own list already contains a polar residue (Ser) and two non-hydrophobic residues (His, Lys). Asn — polar, uncharged, hydrogen-bonding, and a standard "remove the hydrophobic P1' residue" choice — is a predictable member of that class. This is the classic KSR "obvious to try" posture: a small, identified set of solutions with a reasonable expectation of success.

2.3 Variable (C) — the N-terminal caps

Two sub-arguments, and the second is strong:

(i) Gly-, Met-, Met-Gly- are inherent products of routine recombinant expression. Met is the E. coli translation initiator. Expressing the known sequence QEHPNARKYKGANKK-CNP22 (or its Gly-extended form GQEHPNARK…, itself a known CNP-38-type species) in E. coli necessarily yields M-CNP37 or M-Gly-CNP37 unless the initiator methionine is excised — an unpredictable, host-dependent event. These two species therefore fall out of routine practice; the prior art need only have disclosed the practice (PA-6 discloses recombinant pro-CNP expression; PA-12's admission that CNP-53 is enzymatically generated makes the recombinant route the natural production route).

(ii) The caps are a recognised stability fix. N-terminal Gln→pyroglutamate cyclisation is textbook peptide chemistry; appending a Gly (and/or a Pro-Gly cleavage remnant) ahead of Gln is the standard, well-known prophylactic. The '242's own specification concedes exactly this rationale for Pro-Gly-CNP37 ("designed to prevent pyroglutamine formation"). Under KSR, using a known technique to improve a known peptide in the same way is obvious.

2.4 Claim 1 — combination summary

PA-1/PA-2 (treat skeletal dysplasia with NPs; substitute Met17 to defeat NEP; prolong residence time) + PA-3 (position-17 mutants retain NPR-B activity) + PA-4 (NEP can't handle >3 kDa → use the longer natural form) + PA-5 (Ser16-Met17 is a specific NEP scissile bond) + PA-6/PA-7/PA-8/PA-13 (CNP37 is a known, activity-equivalent, N-terminally dispensable natural form) — each element being known, and the combination producing no more than the sum of its parts.

Every element of claim 1 is disclosed; the only genuinely asserted "gap" is that no single reference recites the exact six sequences.

2.5 Species-specific risk (be candid)

The Markush is closed and narrow. A single-species attack is the cleanest route — the Federal Circuit treats a Markush claim as anticipated by a reference disclosing any member, and by parity a reference rendering one member obvious puts the claim as a whole in serious jeopardy. On the record above, the easiest targets are SEQ ID NO:191 (Met-Gly-CNP37) and SEQ ID NO:192 (Met-CNP37), because they are inherent in recombinant expression of the claimed-in-any-event CNP37 backbone. The hardest target is SEQ ID NO:182 (CNP37(M32N)), because the specific Asn residue is not literally named anywhere I could retrieve.

---

3. Dependent claims 2–3 — pharmaceutical composition and lyophilised citrate/acetate pH 4–6 formulation

Pharmaceutical formulation of a peptide with a pharmaceutically acceptable carrier/diluent, and lyophilisation from an acetate or citrate buffer at pH 4–6, are among the most routine operations in biotechnology. Acetate/citrate buffers in that pH window are the standard choice for CNP/BNP-type peptides. The '242's own working examples use them. Obvious if claim 1 is obvious; the pH range is a result-effective variable optimised by routine testing.

---

4. Claim 4 — treating achondroplasia

Directly met by PA-1 (Hepacore), whose stated purpose is treating skeletal dysplasias including achondroplasia with natriuretic peptides, and by PA-13 (Chusho) showing the CNP/NPR-B axis controls long-bone growth, plus the '242 background's own admission that "CNP and functional variants of CNP are potential therapeutics for treatment of the various skeletal dysplasias." The only additional requirement is that the administered variant be a claim-1 variant — so the claim rises or falls with claim 1. The motivation is expressly articulated in PA-1 ("prolonging its residence time or action at the target site").

---

5. Claims 5–12 — recombinant production via cleavable fusion partners

This is the weakest family of claims on obviousness grounds.

• Claims 5–6 (fusion to a cleavable peptide/protein; TAF12, TAF12(C/A), TAF12(D/E), KSI, MBP, β-galactosidase, GST, thioredoxin, chitin-binding domain, BMP-2). Affinity/carrier-tag fusion expression with subsequent site-specific cleavage is the canonical method of E. coli peptide production, and the '242's own specification confirms it by reciting commercial vectors — pET-21a, pET-31b, pET-15b, pET-32a, pET-41a, pMAL, pQE-30, pET-SUMO, pET-22b, pTYB11 — every one of which is an off-the-shelf tag-fusion system. The Non-Patent Citations on the family include Ausubel, Short Protocols in Molecular Biology (mutagenesis and molecular-biology units) and Adelman et al., DNA 2(3):183–193 (1983) (bacterial production of a truncated human pituitary hormone). The generic concept (claim 5) is squarely obvious. Claim 6's TAF12-specific species is the narrowest point of the whole patent on this axis — I found no pre-2009 art teaching TAF12 (human transcription factor) as a peptide-fusion partner, and a POSA would not necessarily have selected it. If any claim survives a § 103 challenge, I would expect it to be a TAF12-limited claim 6 and its dependents.
• Claims 7–9 (bacterial host; soluble vs. inclusion body; isolation). Routine fermentation and protein-purification choices.
• Claim 10 (cleaving agents: formic acid, CNBr, hydroxylamine, self-cleavage, Factor Xa, enterokinase, ProTEV, SUMO protease). Each is a textbook cleavage reagent with a defined specificity — CNBr at Met (Gross & Witkop, 1962), formic acid at Asp-Pro, hydroxylamine at Asn-Gly, Factor Xa/enterokinase at their cognate recognition sequences, SUMO/ProTEV as self-cleaving systems. Listing known reagents with known specificities is obvious.
• Claims 11–12 (the method "which produces" Pro-Gly-CNP37). Purely derivative of claim 1's Pro-Gly-CNP37 species.

---

6. Claims 13–17 — formulation variants and increasing long bone growth

• Claim 13 (isotonicity/bulking agent/antioxidant in a lyophilised peptide formulation) — routine excipient selection.
• Claims 15–17 (increasing long bone growth; Pro-Gly-CNP37 for that use) — the indication is taught by PA-1 and PA-13, and the compound by the claim-1 analysis. Note that Hepacore/PA-2 goes further and discloses that a Met17-substituted CNP peptide "induced elongation of Ach369 femora even at a concentration similar to that of CNP" — i.e. the art already links a Met17 substitution to in vivo bone elongation, which is precisely the pharmacological endpoint of claims 15–17.

---

7. Explicit motivation-to-combine statement

The motivations are not reconstructed after the fact; they are stated in the art:

1. The problem was known and articulated. NEP rapidly degrades CNP (half-life ~2.6 min; PA-5, and characterisation of NEP's ~3 kDa ceiling in PA-4). The '242's own background concedes the goal: a longer-half-life, equally-active CNP.
2. Two complementary solutions were known and combinable. (a) Physical — exceed NEP's ~3 kDa size limit by N-terminal extension (PA-4 + PA-6 + PA-7: CNP-37/CNP-53 are longer, are natural, and are equipotent). (b) Chemical — remove the NEP recognition determinants, specifically at Ser16–Met17 (PA-2 + PA-3 + PA-5). Nothing in the art taught that these were alternatives that could not be used together; they attack different aspects of the same problem, and their combination was the predictable next step.
3. The art supplied a finite, enumerated set of substituents at the very position the claims now recite (PA-2: Ala, Trp, His, Lys, Ser, Gly), with a reasonable expectation of success (PA-3), thereby satisfying KSR's "obvious to try" standard.
4. The N-terminal caps had independent, known rationales — Met as the prokaryotic initiator; Gly/Pro-Gly to suppress N-terminal Gln→pyroglutamate; Pro-Gly as a fusion-cleavage remnant. Applying a known technique to a known peptide to fix a known degradation pathway is the paradigm KSR case.
5. No physiological contraindication existed. PA-7 and PA-8 taught that the Cys6–Cys22 ring alone carries NPR-B binding and that N-terminal extension to 53 residues is activity-neutral, so a POSA had every reason to expect these modifications to be tolerated.

---

8. Anticipated patentee rebuttals, and how they fare

---

9. Bottom line

• Claims 5–12 (recombinant production) are the most vulnerable to § 103 — the fusion-tag/cleavable-partner methodology is old and the patent's own specification proves it by reciting off-the-shelf commercial vectors. Exception: the TAF12-limited species of claim 6, for which I found no pre-2009 teaching.
• Claims 1, 4, 15–17 are vulnerable to a well-constructed combination of Hepacore (PA-1/PA-2) + Furuya (PA-3) + Oefner (PA-4) + Watanabe (PA-5) + the admitted-background CNP-37/CNP-53 art (PA-6, PA-7, PA-8, PA-12, PA-13), with the M32N species resting on KSR "obvious to try" and the Met-/Met-Gly-/Pro-/Pro-Gly- species resting on routine recombinant expression and conventional pyroglutamate prophylaxis.
• Claims 2–3 and 13 fall with routine formulation practice.
• The strongest non-obviousness position available to BioMarin is (i) narrow, sequence-specific claim construction (the claim is a six-member Markush and nothing more) and (ii) unexpected-results evidence specific to M32N — evidence I could not locate in the retrieved record and which should be checked in the '242 file wrapper and in BioMarin's own comparative data.

Residual uncertainties I am flagging rather than papering over: (1) the date of the Hepacore Met17 passage (PA-2) — verify in US 2008/0194682 A1; (2) the exact substituted residues in Furuya 1992 (PA-3), which I have reported via a secondary source (US 2017/0080049); (3) the full bibliographic details of Watanabe 1997 (PA-5), which I have only as "Watanabe et al., 1997" from the PGR2026-00013 exhibit set; and (4) M32N-specific comparative activity data, which is absent from everything I retrieved.